PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.004G070900.1.p
Common NameSb04g005940, SORBIDRAFT_04g005940
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 328aa    MW: 34284.3 Da    PI: 8.3029
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.004G070900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.57.1e-191257147
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                          +g+W++eEde l ++v+++G ++W++I r ++ gR++k+c++rw + 
  Sobic.004G070900.1.p 12 KGPWSPEEDEALRRLVERHGARNWTAIGRGIP-GRSGKSCRLRWCNQ 57
                          79******************************.***********985 PP

2Myb_DNA-binding55.21.6e-1764107146
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           r ++T+eEd  ++ a+++lG++ W++Iar ++ gRt++ +k++w++
  Sobic.004G070900.1.p  64 RRPFTPEEDAAILAAHARLGNR-WAAIARLLP-GRTDNAVKNHWNS 107
                           679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.481762IPR017930Myb domain
SuperFamilySSF466891.95E-319105IPR009057Homeodomain-like
SMARTSM007179.6E-171160IPR001005SANT/Myb domain
PfamPF002494.4E-181257IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-251365IPR009057Homeodomain-like
CDDcd001675.70E-161456No hitNo description
SMARTSM007175.6E-1663111IPR001005SANT/Myb domain
PROSITE profilePS5129421.86164113IPR017930Myb domain
PfamPF002494.0E-1564107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-2466113IPR009057Homeodomain-like
CDDcd001671.38E-1266109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0010200Biological Processresponse to chitin
GO:0042742Biological Processdefense response to bacterium
GO:0046686Biological Processresponse to cadmium ion
GO:0050832Biological Processdefense response to fungus
GO:2000022Biological Processregulation of jasmonic acid mediated signaling pathway
GO:2000031Biological Processregulation of salicylic acid mediated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MGVESSECDR IKGPWSPEED EALRRLVERH GARNWTAIGR GIPGRSGKSC RLRWCNQLSP  60
QVERRPFTPE EDAAILAAHA RLGNRWAAIA RLLPGRTDNA VKNHWNSSLK RKLATATSSG  120
GADIGDPEER PCKRASPAGP GSPTASDRSD LSHGCGGAAQ VFRPVPRAGG FDAISCTADV  180
RPPPPPPAAA AEDYEDPLTS LSLSLPGLDH QSASSGFHHD SARSHFQELS PSRSPSPQST  240
PPPAALLSPP AAAAPSQSSS SSSSYPFSGE LVAAMQEMIR AEVRKYMSGA GLRAGCGPGA  300
VGEAGMPQLV EGVMRAAAER VGVVTRP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-4291154110B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00653PBMTransfer from LOC_Os02g09480Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794090.0HF679409.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB3 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002451692.10.0hypothetical protein SORBIDRAFT_04g005940
SwissprotQ9FDW16e-73MYB44_ARATH; Transcription factor MYB44
TrEMBLC5XX070.0C5XX07_SORBI; Putative uncharacterized protein Sb04g005940
STRINGSb04g005940.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.11e-64myb domain protein r1